Lineage for d1l2jb_ (1l2j B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647938Protein Estrogen receptor beta [48521] (2 species)
  7. 647939Species Human (Homo sapiens) [TaxId:9606] [48522] (15 PDB entries)
  8. 647967Domain d1l2jb_: 1l2j B: [73506]
    complexed with etc

Details for d1l2jb_

PDB Entry: 1l2j (more details), 2.95 Å

PDB Description: Human Estrogen Receptor beta Ligand-binding Domain in Complex with (R,R)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol
PDB Compounds: (B:) Estrogen receptor beta

SCOP Domain Sequences for d1l2jb_:

Sequence, based on SEQRES records: (download)

>d1l2jb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
mrellldalspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswak
kipgfvelslfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegil
eifdmllattsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavt
dalvwviaksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllem
lna

Sequence, based on observed residues (ATOM records): (download)

>d1l2jb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
mrellldalspeqlvltlleaepphvmmmsltkladkelvhmiswakkipgfvelslfdq
vrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsrf
relklqhkeylcvkamillnssmlvtatqdadssrklahllnavtdalvwviaksgissq
qqsmrlanllmllshvrhasnkgmehllnmvpvydlllemlna

SCOP Domain Coordinates for d1l2jb_:

Click to download the PDB-style file with coordinates for d1l2jb_.
(The format of our PDB-style files is described here.)

Timeline for d1l2jb_: