Lineage for d1l1sa_ (1l1s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921138Fold c.114: DsrEFH-like [75168] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215
  4. 2921139Superfamily c.114.1: DsrEFH-like [75169] (3 families) (S)
  5. 2921140Family c.114.1.1: DsrEF-like [75170] (6 proteins)
    Pfam PF02635
  6. 2921141Protein Hypothetical protein MTH1491 [75171] (1 species)
  7. 2921142Species Methanobacterium thermoautotrophicum [TaxId:145262] [75172] (1 PDB entry)
  8. 2921143Domain d1l1sa_: 1l1s A: [73484]
    structural genomics

Details for d1l1sa_

PDB Entry: 1l1s (more details), 2.3 Å

PDB Description: structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum
PDB Compounds: (A:) hypothetical protein MTH1491

SCOPe Domain Sequences for d1l1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l1sa_ c.114.1.1 (A:) Hypothetical protein MTH1491 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
dyrvvfhideddesrvlllisnvrnlmadlesvrievvaysmgvnvlrrdseysgdvsel
tgqgvrfcacsntlrasgmdgddllegvdvvssgvghivrrqtegwayirp

SCOPe Domain Coordinates for d1l1sa_:

Click to download the PDB-style file with coordinates for d1l1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1l1sa_: