| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.114: DsrEFH-like [75168] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 43215 |
Superfamily c.114.1: DsrEFH-like [75169] (3 families) ![]() |
| Family c.114.1.1: DsrEF-like [75170] (6 proteins) Pfam PF02635 |
| Protein Hypothetical protein MTH1491 [75171] (1 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [75172] (1 PDB entry) |
| Domain d1l1sa_: 1l1s A: [73484] structural genomics |
PDB Entry: 1l1s (more details), 2.3 Å
SCOPe Domain Sequences for d1l1sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l1sa_ c.114.1.1 (A:) Hypothetical protein MTH1491 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
dyrvvfhideddesrvlllisnvrnlmadlesvrievvaysmgvnvlrrdseysgdvsel
tgqgvrfcacsntlrasgmdgddllegvdvvssgvghivrrqtegwayirp
Timeline for d1l1sa_: