Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Acyl carrier protein [47338] (7 species) |
Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
Domain d1l0ha_: 1l0h A: [77642] complexed with zn |
PDB Entry: 1l0h (more details), 2 Å
SCOPe Domain Sequences for d1l0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ha_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghq
Timeline for d1l0ha_: