Lineage for d1l0ba1 (1l0b A:1591-1702)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.15: BRCT domain [52112] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134Superfamily c.15.1: BRCT domain [52113] (6 families) 
Pfam PF00533Family c.15.1.3: BRCT domain [63955] (1 protein) Protein Breast cancer associated protein, BRCA1 [63956] (2 species)
duplication: tandem repeat of BRCT domain
Species Norway rat (Rattus norvegicus) [TaxId:10116] [75147] (1 PDB entry) 
Domain d1l0ba1: 1l0b A:1591-1702 [73391]
Details for d1l0ba1
PDB Entry: 1l0b (more details), 2.3 Å
PDB Description: Crystal Structure of rat Brca1 tandem-BRCT region
PDB Compounds: (A:) brca1SCOPe Domain Sequences for d1l0ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ba1 c.15.1.3 (A:1591-1702) Breast cancer associated protein, BRCA1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
raerdismvvsgltpkevmivqkfaekyrlaltdviteetthviiktdaefvcertlkyf
lgiaggkwivsyswviksiqerkllsvhefevkgdvvtgsnhqgprrsresq
SCOPe Domain Coordinates for d1l0ba1:
Click to download the PDB-style file with coordinates for d1l0ba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l0ba1:
- d1l0ba1 first appeared in SCOP 1.61
- d1l0ba1 appears in SCOPe 2.06
- d1l0ba1 appears in the current release, SCOPe 2.08
View in 3D
