| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
| Family c.15.1.3: BRCT domain [63955] (1 protein) |
| Protein Breast cancer associated protein, BRCA1 [63956] (2 species) duplication: tandem repeat of BRCT domain |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [75147] (1 PDB entry) |
| Domain d1l0ba1: 1l0b A:1591-1702 [73391] |
PDB Entry: 1l0b (more details), 2.3 Å
SCOPe Domain Sequences for d1l0ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ba1 c.15.1.3 (A:1591-1702) Breast cancer associated protein, BRCA1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
raerdismvvsgltpkevmivqkfaekyrlaltdviteetthviiktdaefvcertlkyf
lgiaggkwivsyswviksiqerkllsvhefevkgdvvtgsnhqgprrsresq
Timeline for d1l0ba1: