Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) |
Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
Protein Lumazine synthase [52123] (7 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
Domain d1kyve_: 1kyv E: [73295] complexed with po4, rbf |
PDB Entry: 1kyv (more details), 2.4 Å
SCOPe Domain Sequences for d1kyve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyve_ c.16.1.1 (E:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} gpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelp qgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvln eeqalyraglngghnhgndwgsaavemglkal
Timeline for d1kyve_:
View in 3D Domains from other chains: (mouse over for more information) d1kyva_, d1kyvb_, d1kyvc_, d1kyvd_ |