![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.4: YjeF C-terminal domain-like [75292] (3 proteins) automatically mapped to Pfam PF01256 |
![]() | Protein Hypothetical protein YxkO [75293] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [75294] (1 PDB entry) |
![]() | Domain d1kyha_: 1kyh A: [73222] structural genomics |
PDB Entry: 1kyh (more details), 1.6 Å
SCOPe Domain Sequences for d1kyha_:
Sequence, based on SEQRES records: (download)
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} nvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklvig tsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvlta dcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqt vivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavy lhgacaelwtdehsahtllahelsdilprvwkrfe
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} nvpfwteehvratlpertygtalllagsddmpgaallaglgamrsglgklvigtsenvip livpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvltadcpvild agalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqtvivlkgn qtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavylhgacae lwtdehsahtllahelsdilprvwkrfe
Timeline for d1kyha_: