![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (16 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (18 proteins) |
![]() | Protein Alkyl hydroperoxide reductase AhpC [69516] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [69517] (2 PDB entries) |
![]() | Domain d1kyga_: 1kyg A: [68881] |
PDB Entry: 1kyg (more details), 2.5 Å
SCOP Domain Sequences for d1kyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyga_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium} slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp
Timeline for d1kyga_:
![]() Domains from other chains: (mouse over for more information) d1kygb_, d1kygc_, d1kygd_, d1kyge_ |