Lineage for d1kyga_ (1kyg A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 585201Family c.47.1.10: Glutathione peroxidase-like [52901] (18 proteins)
  6. 585211Protein Alkyl hydroperoxide reductase AhpC [69516] (1 species)
  7. 585212Species Salmonella typhimurium [TaxId:90371] [69517] (2 PDB entries)
  8. 585233Domain d1kyga_: 1kyg A: [68881]

Details for d1kyga_

PDB Entry: 1kyg (more details), 2.5 Å

PDB Description: X-ray Crystal Structure of AhpC

SCOP Domain Sequences for d1kyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyga_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcp

SCOP Domain Coordinates for d1kyga_:

Click to download the PDB-style file with coordinates for d1kyga_.
(The format of our PDB-style files is described here.)

Timeline for d1kyga_: