Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) |
Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species) duplication: tandem repeat of two PDZ domains |
Species Escherichia coli [TaxId:562] [74935] (4 PDB entries) |
Domain d1ky9b1: 1ky9 B:260-358 [73200] Other proteins in same PDB: d1ky9a2, d1ky9b3 |
PDB Entry: 1ky9 (more details), 2.8 Å
SCOPe Domain Sequences for d1ky9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ky9b1 b.36.1.4 (B:260-358) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss
Timeline for d1ky9b1: