Lineage for d1kx5d_ (1kx5 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2311535Protein Histone H2B [47119] (6 species)
  7. 2311536Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2311537Domain d1kx5d_: 1kx5 D: [77596]
    Other proteins in same PDB: d1kx5a_, d1kx5b_, d1kx5c_, d1kx5e_, d1kx5f_, d1kx5g_
    protein/DNA complex; complexed with cl, mn

Details for d1kx5d_

PDB Entry: 1kx5 (more details), 1.94 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
PDB Compounds: (D:) histone h2b.2

SCOPe Domain Sequences for d1kx5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx5d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
ak

SCOPe Domain Coordinates for d1kx5d_:

Click to download the PDB-style file with coordinates for d1kx5d_.
(The format of our PDB-style files is described here.)

Timeline for d1kx5d_: