Lineage for d1kx4d_ (1kx4 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2698209Domain d1kx4d_: 1kx4 D: [77588]
    Other proteins in same PDB: d1kx4a_, d1kx4b_, d1kx4c_, d1kx4e_, d1kx4f_, d1kx4g_
    protein/DNA complex; complexed with cl, mn

Details for d1kx4d_

PDB Entry: 1kx4 (more details), 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution
PDB Compounds: (D:) histone h2b.2

SCOPe Domain Sequences for d1kx4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx4d_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1kx4d_:

Click to download the PDB-style file with coordinates for d1kx4d_.
(The format of our PDB-style files is described here.)

Timeline for d1kx4d_: