Lineage for d1kwna_ (1kwn A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663000Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 663001Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 663002Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 663010Protein Thaumatin [49876] (1 species)
  7. 663011Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (18 PDB entries)
  8. 663013Domain d1kwna_: 1kwn A: [77568]
    complexed with tar

Details for d1kwna_

PDB Entry: 1kwn (more details), 1.2 Å

PDB Description: 1.2 a structure of thaumatin crystallized in gel
PDB Compounds: (A:) thaumatin I

SCOP Domain Sequences for d1kwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwna_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1kwna_:

Click to download the PDB-style file with coordinates for d1kwna_.
(The format of our PDB-style files is described here.)

Timeline for d1kwna_: