Lineage for d1kv8a_ (1kv8 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) 
Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species) Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
Uniprot P39304
Domain d1kv8a_: 1kv8 A: [73054]
complexed with mg, po4
Details for d1kv8a_
PDB Entry: 1kv8 (more details), 1.62 Å
PDB Description: Crystal Structure of 3-Keto-L-Gulonate 6-Phosphate Decarboxylase
PDB Compounds: (A:) 3-Keto-L-Gulonate 6-Phosphate DecarboxylaseSCOPe Domain Sequences for d1kv8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv8a_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw
SCOPe Domain Coordinates for d1kv8a_:
Click to download the PDB-style file with coordinates for d1kv8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kv8a_:
- d1kv8a_ first appeared in SCOP 1.61
- d1kv8a_ appears in SCOPe 2.04
- d1kv8a_ appears in SCOPe 2.06
- d1kv8a_ appears in the current release, SCOPe 2.08
View in 3D
