Lineage for d1kv7a3 (1kv7 A:336-516)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species)
  7. Species Escherichia coli [TaxId:562] [419323] (38 PDB entries)
  8. Domain d1kv7a3: 1kv7 A:336-516 [68875]
    Other proteins in same PDB: d1kv7a1, d1kv7a2
    complexed with c2o, cu

Details for d1kv7a3

PDB Entry: 1kv7 (more details), 1.4 Å

PDB Description: Crystal Structure of CueO, a multi-copper oxidase from E. coli involved in copper homeostasis
PDB Compounds: (A:) probable blue-copper protein yack

SCOPe Domain Sequences for d1kv7a3:

Sequence, based on SEQRES records: (download)

>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d1kv7a3 are not available.

Timeline for d1kv7a3:

Domains from same chain:
(mouse over for more information)
d1kv7a1, d1kv7a2