![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
![]() | Protein Transglutaminase catalytic domain [54045] (4 species) |
![]() | Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [75333] (5 PDB entries) GDP-binding protein |
![]() | Domain d1kv3a4: 1kv3 A:146-468 [73030] Other proteins in same PDB: d1kv3a1, d1kv3a2, d1kv3a3, d1kv3b1, d1kv3b2, d1kv3b3, d1kv3c1, d1kv3c2, d1kv3c3, d1kv3d1, d1kv3d2, d1kv3d3, d1kv3e1, d1kv3e2, d1kv3e3, d1kv3f1, d1kv3f2, d1kv3f3 complexed with gdp |
PDB Entry: 1kv3 (more details), 2.8 Å
SCOPe Domain Sequences for d1kv3a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv3a4 d.3.1.4 (A:146-468) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} davyldseeerqeyvltqqgfiyqgsakfiknipwnfgqfqdgildiclilldvnpkflk nagrdcsrrsspvyvgrvgsgmvncnddqgvllgrwdnnygdgvspmswigsvdilrrwk nhgcqrvkygqcwvfaavactvlrclgiptrvvtnynsahdqnsnllieyfrnefgeiqg dksemiwnfhcwveswmtrpdlqpgyegwqaldptpqeksegtyccgpvpvraikegdls tkydapfvfaevnadvvdwiqqddgsvhksinrslivglkistksvgrderedithtyky pegsseereaftranhlnklaek
Timeline for d1kv3a4: