Lineage for d1kv3a2 (1kv3 A:469-585)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763296Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2763297Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2763298Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2763371Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (5 PDB entries)
    GDP-binding protein
  8. 2763386Domain d1kv3a2: 1kv3 A:469-585 [73028]
    Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4
    complexed with gdp

Details for d1kv3a2

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form
PDB Compounds: (A:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1kv3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kv3a2 b.1.5.1 (A:469-585) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
eetgmamrirvgqsmnmgsdfdvfahitnntaeeyvcrlllcartvsyngilgpecgtky
llnltlepfseksvplcilyekyrdcltesnlikvrallvepvinsyllaerdlyle

SCOPe Domain Coordinates for d1kv3a2:

Click to download the PDB-style file with coordinates for d1kv3a2.
(The format of our PDB-style files is described here.)

Timeline for d1kv3a2: