Lineage for d1ktpb_ (1ktp B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
automatically mapped to Pfam PF00502
Protein Phycocyanin beta subunit [88940] (8 species) 
Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries) 
Domain d1ktpb_: 1ktp B: [72991]
Other proteins in same PDB: d1ktpa_
complexed with bla, cyc
Details for d1ktpb_
PDB Entry: 1ktp (more details), 1.6 Å
PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms
PDB Compounds: (B:) c-phycocyanin beta subunitSCOPe Domain Sequences for d1ktpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktpb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
SCOPe Domain Coordinates for d1ktpb_:
Click to download the PDB-style file with coordinates for d1ktpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ktpb_:
- d1ktpb_ first appeared in SCOP 1.61
- d1ktpb_ appears in SCOPe 2.03
- d1ktpb_ appears in SCOPe 2.05
- d1ktpb_ appears in the current release, SCOPe 2.08
View in 3D
