Lineage for d1ktpb_ (1ktp B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475382Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1475475Protein Phycocyanin beta subunit [88940] (8 species)
  7. 1475512Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries)
  8. 1475515Domain d1ktpb_: 1ktp B: [72991]
    Other proteins in same PDB: d1ktpa_
    complexed with bla, cyc

Details for d1ktpb_

PDB Entry: 1ktp (more details), 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms
PDB Compounds: (B:) c-phycocyanin beta subunit

SCOPe Domain Sequences for d1ktpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktpb_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOPe Domain Coordinates for d1ktpb_:

Click to download the PDB-style file with coordinates for d1ktpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ktpb_: