| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [52847] (1 PDB entry) |
| Domain d1ktea_: 1kte A: [32771] |
PDB Entry: 1kte (more details), 2.2 Å
SCOPe Domain Sequences for d1ktea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}
aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk
Timeline for d1ktea_: