Lineage for d1ktba2 (1ktb A:1-293)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818560Protein Melibiase [75064] (4 species)
  7. 1818561Species Chicken (Gallus gallus) [TaxId:9031] [75065] (2 PDB entries)
    alpha-N-acetylgalactosaminidase
  8. 1818562Domain d1ktba2: 1ktb A:1-293 [72961]
    Other proteins in same PDB: d1ktba1
    complexed with acy, gol, nag, so4

Details for d1ktba2

PDB Entry: 1ktb (more details), 1.9 Å

PDB Description: the structure of alpha-n-acetylgalactosaminidase
PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d1ktba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktba2 c.1.8.1 (A:1-293) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]}
lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini
ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld
rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl
ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii
gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdp

SCOPe Domain Coordinates for d1ktba2:

Click to download the PDB-style file with coordinates for d1ktba2.
(The format of our PDB-style files is described here.)

Timeline for d1ktba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ktba1