Lineage for d1ktba2 (1ktb A:1-293)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Melibiase [75064] (4 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [75065] (2 PDB entries)
alpha-N-acetylgalactosaminidase
Domain d1ktba2: 1ktb A:1-293 [72961]
Other proteins in same PDB: d1ktba1
complexed with acy, gol, nag, so4
Details for d1ktba2
PDB Entry: 1ktb (more details), 1.9 Å
PDB Description: the structure of alpha-n-acetylgalactosaminidase
PDB Compounds: (A:) alpha-N-acetylgalactosaminidaseSCOPe Domain Sequences for d1ktba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktba2 c.1.8.1 (A:1-293) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]}
lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini
ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld
rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl
ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii
gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdp
SCOPe Domain Coordinates for d1ktba2:
Click to download the PDB-style file with coordinates for d1ktba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ktba2:
- d1ktba2 first appeared in SCOP 1.61
- d1ktba2 appears in SCOPe 2.02
- d1ktba2 appears in SCOPe 2.04
- d1ktba2 appears in the current release, SCOPe 2.08
View in 3D
