![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Melibiase [75020] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [75021] (2 PDB entries) alpha-N-acetylgalactosaminidase |
![]() | Domain d1ktba1: 1ktb A:294-388 [72960] Other proteins in same PDB: d1ktba2 complexed with acy, gol, nag, so4 |
PDB Entry: 1ktb (more details), 1.9 Å
SCOPe Domain Sequences for d1ktba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktba1 b.71.1.1 (A:294-388) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]} lgiqgrriikegshievflrplsqaasalvffsrrtdmpfryttslaklgfpmgaayevq dvysgkiisglktgdnftviinpsgvvmwylcpka
Timeline for d1ktba1: