Lineage for d1ktba1 (1ktb A:294-388)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328233Protein Melibiase [75020] (4 species)
  7. 1328234Species Chicken (Gallus gallus) [TaxId:9031] [75021] (2 PDB entries)
    alpha-N-acetylgalactosaminidase
  8. 1328235Domain d1ktba1: 1ktb A:294-388 [72960]
    Other proteins in same PDB: d1ktba2
    complexed with acy, gol, nag, so4

Details for d1ktba1

PDB Entry: 1ktb (more details), 1.9 Å

PDB Description: the structure of alpha-n-acetylgalactosaminidase
PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d1ktba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktba1 b.71.1.1 (A:294-388) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]}
lgiqgrriikegshievflrplsqaasalvffsrrtdmpfryttslaklgfpmgaayevq
dvysgkiisglktgdnftviinpsgvvmwylcpka

SCOPe Domain Coordinates for d1ktba1:

Click to download the PDB-style file with coordinates for d1ktba1.
(The format of our PDB-style files is described here.)

Timeline for d1ktba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ktba2