| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
| Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species) |
| Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries) Uniprot P13466 547-857 |
| Domain d1ksra_: 1ksr A: [21897] one repeat (Rod 4) |
PDB Entry: 1ksr (more details)
SCOPe Domain Sequences for d1ksra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksra_ b.1.18.10 (A:) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa
Timeline for d1ksra_: