Lineage for d1ksoa_ (1kso A:)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.2: S100 proteins [47478] (2 proteins)
dimer: subunits are made of two EF-handsProtein Calcyclin (S100) [47479] (17 species) 
Species Human (Homo sapiens), s100a3 [TaxId:9606] [74720] (1 PDB entry) 
Domain d1ksoa_: 1kso A: [72926]
Details for d1ksoa_
PDB Entry: 1kso (more details), 1.7 Å
PDB Description: crystal structure of apo s100a3
PDB Compounds: (A:) s100 calcium-binding protein a3SCOPe Domain Sequences for d1ksoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}
arpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfmsv
ldtnkdcevdfveyvrslaclclycheyfkdcp
SCOPe Domain Coordinates for d1ksoa_:
Click to download the PDB-style file with coordinates for d1ksoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksoa_:
- d1ksoa_ first appeared in SCOP 1.61
- d1ksoa_ appears in SCOP 1.75
- d1ksoa_ appears in SCOPe 2.02
- d1ksoa_ appears in the current release, SCOPe 2.08
View in 3D
