Lineage for d1ks9a1 (1ks9 A:168-291)
- Root: SCOPe 2.02
Class a: All alpha proteins [46456] (284 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein) Protein Ketopantoate reductase PanE [69085] (1 species) Species Escherichia coli [TaxId:562] [69086] (4 PDB entries) 
Domain d1ks9a1: 1ks9 A:168-291 [68857]
Other proteins in same PDB: d1ks9a2
Details for d1ks9a1
PDB Entry: 1ks9 (more details), 1.7 Å
PDB Description: Ketopantoate Reductase from Escherichia coli
PDB Compounds: (A:) 2-dehydropantoate 2-reductaseSCOPe Domain Sequences for d1ks9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
kese
SCOPe Domain Coordinates for d1ks9a1:
Click to download the PDB-style file with coordinates for d1ks9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ks9a1:
- d1ks9a1 first appeared in SCOP 1.59
- d1ks9a1 appears in SCOPe 2.01
- d1ks9a1 appears in SCOPe 2.03
- d1ks9a1 appears in the current release, SCOPe 2.08
View in 3D
