Lineage for d1kr7a_ (1kr7 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 903995Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
  6. 903996Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 903997Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (5 PDB entries)
    Uniprot O76242
  8. 903999Domain d1kr7a_: 1kr7 A: [72890]
    complexed with act, hem, oxy, so4

Details for d1kr7a_

PDB Entry: 1kr7 (more details), 1.5 Å

PDB Description: Crystal structure of the nerve tissue mini-hemoglobin from the nemertean worm Cerebratulus lacteus
PDB Compounds: (A:) Neural globin

SCOPe Domain Sequences for d1kr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

SCOPe Domain Coordinates for d1kr7a_:

Click to download the PDB-style file with coordinates for d1kr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr7a_: