Lineage for d1kqka_ (1kqk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196954Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
    duplication: contains tandem repeat of two HMA domains in the N-terminal region
  7. 2196955Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)
  8. 2196956Domain d1kqka_: 1kqk A: [72880]
    domain 2
    complexed with cu1

Details for d1kqka_

PDB Entry: 1kqk (more details)

PDB Description: solution structure of the n-terminal domain of a potential copper- translocating p-type atpase from bacillus subtilis in the cu(i)loaded state
PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1kqka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqka_ d.58.17.1 (A:) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
mtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
vdklgyklklkgeqdsiegr

SCOPe Domain Coordinates for d1kqka_:

Click to download the PDB-style file with coordinates for d1kqka_.
(The format of our PDB-style files is described here.)

Timeline for d1kqka_: