Lineage for d1kpsb_ (1kps B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727312Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2727313Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2727314Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 2727325Species Mouse (Mus musculus) [TaxId:10090] [69102] (1 PDB entry)
  8. 2727326Domain d1kpsb_: 1kps B: [68787]
    Other proteins in same PDB: d1kpsa1, d1kpsa2, d1kpsc_
    complexed with so4

Details for d1kpsb_

PDB Entry: 1kps (more details), 2.5 Å

PDB Description: structural basis for e2-mediated sumo conjugation revealed by a complex between ubiquitin conjugating enzyme ubc9 and rangap1
PDB Compounds: (B:) Ran-GTPase activating protein 1

SCOPe Domain Sequences for d1kpsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpsb_ a.118.12.1 (B:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
tdlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavl
daidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyf
pkalaplllafvtkpngaletcsfarhnllqtlyni

SCOPe Domain Coordinates for d1kpsb_:

Click to download the PDB-style file with coordinates for d1kpsb_.
(The format of our PDB-style files is described here.)

Timeline for d1kpsb_: