Lineage for d1ko2a_ (1ko2 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231320Species Pseudomonas aeruginosa, VIM-2 [TaxId:287] [103316] (2 PDB entries)
  8. 2231322Domain d1ko2a_: 1ko2 A: [90973]
    complexed with act, zn

Details for d1ko2a_

PDB Entry: 1ko2 (more details), 2.2 Å

PDB Description: VIM-2, a Zn-beta-lactamase from Pseudomonas aeruginosa with an oxidized Cys (cysteinesulfonic)
PDB Compounds: (A:) VIM-2 metallo-beta-lactamase

SCOPe Domain Sequences for d1ko2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ko2a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn

SCOPe Domain Coordinates for d1ko2a_:

Click to download the PDB-style file with coordinates for d1ko2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ko2a_: