![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein Allophycocyanin alpha subunit [88953] (3 species) |
![]() | Species Red algae (Porphyra yezoensis) [TaxId:2788] [88956] (1 PDB entry) |
![]() | Domain d1kn1a_: 1kn1 A: [77455] Other proteins in same PDB: d1kn1b_ complexed with cyc |
PDB Entry: 1kn1 (more details), 2.2 Å
SCOPe Domain Sequences for d1kn1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kn1a_ a.1.1.3 (A:) Allophycocyanin alpha subunit {Red algae (Porphyra yezoensis) [TaxId: 2788]} sivtksivnadaearylspgeldriksfvlsgarrvriaqtltenrerivkqagdqlfqk rpdvvspggnaygeemtatclrdldyylrlvtygivsgdvtpieeiglvgvremykslgt pisavaegvkcmksvassllsgedsaeagfyfdyvvgamq
Timeline for d1kn1a_: