Lineage for d1kmta_ (1kmt A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) 
Domain d1kmta_: 1kmt A: [77442]
mutant
Details for d1kmta_
PDB Entry: 1kmt (more details), 1.3 Å
PDB Description: crystal structure of rhogdi glu(154,155)ala mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1SCOPe Domain Sequences for d1kmta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmta_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw
SCOPe Domain Coordinates for d1kmta_:
Click to download the PDB-style file with coordinates for d1kmta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kmta_:
- d1kmta_ first appeared in SCOP 1.63
- d1kmta_ appears in SCOPe 2.04
- d1kmta_ is called d1kmta1 in SCOPe 2.06
- d1kmta_ appears in the current release, SCOPe 2.08, called d1kmta1
View in 3D
