Lineage for d1kmma1 (1kmm A:326-424)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) 
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) 
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) 
Species Escherichia coli [TaxId:562] [52957] (4 PDB entries) 
Domain d1kmma1: 1kmm A:326-424 [33174]
Other proteins in same PDB: d1kmma2, d1kmmb2, d1kmmc2, d1kmmd2
protein/RNA complex; complexed with ham
Details for d1kmma1
PDB Entry: 1kmm (more details), 2.6 Å
PDB Description: histidyl-trna synthetase complexed with histidyl-adenylate
PDB Compounds: (A:) histidyl-tRNA synthetaseSCOPe Domain Sequences for d1kmma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg
SCOPe Domain Coordinates for d1kmma1:
Click to download the PDB-style file with coordinates for d1kmma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kmma1:
View in 3D
