Lineage for d1klya_ (1kly A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1143783Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1143823Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 1143860Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)
  8. 1143866Domain d1klya_: 1kly A: [72730]
    complexed with up6; mutant

Details for d1klya_

PDB Entry: 1kly (more details), 1.5 Å

PDB Description: orotidine monophosphate decarboxylase d70g mutant complexed with 6- azaump
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d1klya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klya_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiag
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

SCOPe Domain Coordinates for d1klya_:

Click to download the PDB-style file with coordinates for d1klya_.
(The format of our PDB-style files is described here.)

Timeline for d1klya_: