Lineage for d1klil_ (1kli L:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747714Protein Coagulation factor VIIa [57201] (1 species)
  7. 747715Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries)
  8. 747718Domain d1klil_: 1kli L: [77436]
    Other proteins in same PDB: d1klih_
    C-terminal domain
    complexed with ben, ca, gol, so4

Details for d1klil_

PDB Entry: 1kli (more details), 1.69 Å

PDB Description: Cofactor-and substrate-assisted activation of factor VIIa
PDB Compounds: (L:) factor VIIa

SCOP Domain Sequences for d1klil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klil_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
hkddqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilek
r

SCOP Domain Coordinates for d1klil_:

Click to download the PDB-style file with coordinates for d1klil_.
(The format of our PDB-style files is described here.)

Timeline for d1klil_:

747718
d1klil_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1klih_