Lineage for d1kkxa_ (1kkx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692925Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 2692926Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 2692938Protein Transcription regulator Adr6 (Swi1) [74672] (1 species)
  7. 2692939Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74673] (2 PDB entries)
  8. 2692940Domain d1kkxa_: 1kkx A: [72662]

Details for d1kkxa_

PDB Entry: 1kkx (more details)

PDB Description: solution structure of the dna-binding domain of adr6
PDB Compounds: (A:) Transcription regulatory protein ADR6

SCOPe Domain Sequences for d1kkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnkqyelfmkslienckkrnmplqsipeignrkinlfylymlvqkfggadqvtrtqqwsm
vaqrlqisdyqqlesiyfrillpyerhmisqegiketqakri

SCOPe Domain Coordinates for d1kkxa_:

Click to download the PDB-style file with coordinates for d1kkxa_.
(The format of our PDB-style files is described here.)

Timeline for d1kkxa_: