Lineage for d1kklj_ (1kkl J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965939Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries)
  8. 2965949Domain d1kklj_: 1kkl J: [72653]
    Other proteins in same PDB: d1kkla_, d1kklb_, d1kklc_
    complexed with HprK/P kinase domain
    complexed with ca

Details for d1kklj_

PDB Entry: 1kkl (more details), 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis hpr
PDB Compounds: (J:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1kklj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kklj_ d.94.1.1 (J:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
maqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvmslgiakgae
itisasgadendalnaleetmkserlge

SCOPe Domain Coordinates for d1kklj_:

Click to download the PDB-style file with coordinates for d1kklj_.
(The format of our PDB-style files is described here.)

Timeline for d1kklj_: