Lineage for d1kkea2 (1kke A:313-455)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777028Family b.21.1.2: Reovirus attachment protein sigma 1 head domain [69225] (2 proteins)
  6. 2777029Protein Reovirus attachment protein sigma 1 head domain [69226] (1 species)
  7. 2777030Species Reovirus [TaxId:10891] [69227] (1 PDB entry)
  8. 2777031Domain d1kkea2: 1kke A:313-455 [68670]
    Other proteins in same PDB: d1kkea1, d1kkeb1, d1kkec1

Details for d1kkea2

PDB Entry: 1kke (more details), 2.6 Å

PDB Description: Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
PDB Compounds: (A:) sigma 1 protein

SCOPe Domain Sequences for d1kkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkea2 b.21.1.2 (A:313-455) Reovirus attachment protein sigma 1 head domain {Reovirus [TaxId: 10891]}
yrfrqsmwigivsysgsglnwrvqvnsdifivddyihiclpafdgfsiadggdlslnfvt
gllpplltgdtepafhndvvtygaqtvaiglssggapqymsknlwveqwqdgvlrlrveg
ggsithsnskwpamtvsyprsft

SCOPe Domain Coordinates for d1kkea2:

Click to download the PDB-style file with coordinates for d1kkea2.
(The format of our PDB-style files is described here.)

Timeline for d1kkea2: