Lineage for d1kkea1 (1kke A:250-312)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817404Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 2817405Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families) (S)
  5. 2817424Family b.83.1.2: Reovirus attachment protein sigma 1 [69356] (1 protein)
  6. 2817425Protein Reovirus attachment protein sigma 1 [69357] (1 species)
  7. 2817426Species Reovirus [TaxId:10891] [69358] (1 PDB entry)
  8. 2817427Domain d1kkea1: 1kke A:250-312 [68669]
    Other proteins in same PDB: d1kkea2, d1kkeb2, d1kkec2

Details for d1kkea1

PDB Entry: 1kke (more details), 2.6 Å

PDB Description: Crystal Structure of Reovirus Attachment Protein Sigma1 Trimer
PDB Compounds: (A:) sigma 1 protein

SCOPe Domain Sequences for d1kkea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkea1 b.83.1.2 (A:250-312) Reovirus attachment protein sigma 1 {Reovirus [TaxId: 10891]}
eqsyvasavtplrlnsstkvldmlidsstleinssgqltvrstspnlrypiadvsggigm
spn

SCOPe Domain Coordinates for d1kkea1:

Click to download the PDB-style file with coordinates for d1kkea1.
(The format of our PDB-style files is described here.)

Timeline for d1kkea1: