![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry) |
![]() | Domain d1kkca2: 1kkc A:98-213 [68661] Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1 complexed with mn |
PDB Entry: 1kkc (more details), 2 Å
SCOPe Domain Sequences for d1kkca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdk
Timeline for d1kkca2: