Lineage for d1kjwa1 (1kjw A:430-525)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helixSuperfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 proteins) 
Protein Psd-95 [69248] (1 species)
associates with a guanylate kinase domainSpecies Norway rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries) 
Domain d1kjwa1: 1kjw A:430-525 [68643]
Other proteins in same PDB: d1kjwa2
complexed with so4
Details for d1kjwa1
PDB Entry: 1kjw (more details), 1.8 Å
PDB Description: sh3-guanylate kinase module from psd-95
PDB Compounds: (A:) postsynaptic density protein 95SCOPe Domain Sequences for d1kjwa1:
Sequence, based on SEQRES records: (download)
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet
Sequence, based on observed residues (ATOM records): (download)
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkwgsssgsqgredsvlsyet
SCOPe Domain Coordinates for d1kjwa1:
Click to download the PDB-style file with coordinates for d1kjwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kjwa1:
- d1kjwa1 first appeared in SCOP 1.59
- d1kjwa1 appears in SCOPe 2.04
- d1kjwa1 appears in SCOPe 2.06
- d1kjwa1 appears in the current release, SCOPe 2.08
View in 3D
