Lineage for d1kjvb_ (1kjv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746754Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)
  8. 2746755Domain d1kjvb_: 1kjv B: [77423]
    Other proteins in same PDB: d1kjva1, d1kjva2
    complexed with so4

Details for d1kjvb_

PDB Entry: 1kjv (more details), 1.48 Å

PDB Description: tap-b-associated rat mhc class i molecule
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1kjvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjvb_ b.1.1.2 (B:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
miqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskd
wsfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOPe Domain Coordinates for d1kjvb_:

Click to download the PDB-style file with coordinates for d1kjvb_.
(The format of our PDB-style files is described here.)

Timeline for d1kjvb_: