Lineage for d1kjva1 (1kjv A:182-276)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) Protein Class I MHC, alpha-3 domain [88604] (4 species) 
Species Norway rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries) 
Domain d1kjva1: 1kjv A:182-276 [77421]
Other proteins in same PDB: d1kjva2, d1kjvb_
complexed with so4
Details for d1kjva1
PDB Entry: 1kjv (more details), 1.48 Å
PDB Description: tap-b-associated rat mhc class i molecule
PDB Compounds: (A:) Mature alpha chain of major histocompatibility complex class I antigen (HEAVY CHAIN)SCOPe Domain Sequences for d1kjva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjva1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Norway rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppkahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwep
SCOPe Domain Coordinates for d1kjva1:
Click to download the PDB-style file with coordinates for d1kjva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kjva1:
- d1kjva1 first appeared in SCOP 1.63
- d1kjva1 appears in SCOPe 2.02
- d1kjva1 appears in SCOPe 2.04
- d1kjva1 appears in the current release, SCOPe 2.08
View in 3D
