Lineage for d1kjka_ (1kjk A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716390Fold d.10: DNA-binding domain [54170] (1 superfamily)
    beta(3)-alpha; 2 layers: alpha/beta
  4. 716391Superfamily d.10.1: DNA-binding domain [54171] (4 families) (S)
  5. 716415Family d.10.1.4: lambda integrase N-terminal domain [75344] (1 protein)
  6. 716416Protein lambda integrase N-terminal domain [75345] (1 species)
  7. 716417Species Bacteriophage lambda [TaxId:10710] [75346] (3 PDB entries)
  8. 716420Domain d1kjka_: 1kjk A: [72613]

Details for d1kjka_

PDB Entry: 1kjk (more details)

PDB Description: solution structure of the lambda integrase amino-terminal domain
PDB Compounds: (A:) integrase

SCOP Domain Sequences for d1kjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjka_ d.10.1.4 (A:) lambda integrase N-terminal domain {Bacteriophage lambda [TaxId: 10710]}
dlppnlyirnngyycyrdprtgkefglgrdrriaiteaiqanielfsgh

SCOP Domain Coordinates for d1kjka_:

Click to download the PDB-style file with coordinates for d1kjka_.
(The format of our PDB-style files is described here.)

Timeline for d1kjka_: