Lineage for d1kiya_ (1kiy A:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.128: Terpenoid synthases [48575] (1 superfamily)
multihelical; core: 8 helices (C-J) are arranged in 2 parallel layersSuperfamily a.128.1: Terpenoid synthases [48576] (5 families) 
duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
Family a.128.1.5: Trichodiene synthase [69113] (1 protein) Protein Trichodiene synthase [69114] (1 species) Species Fusarium sporotrichioides [TaxId:5514] [69115] (6 PDB entries) 
Domain d1kiya_: 1kiy A: [72555]
Details for d1kiya_
PDB Entry: 1kiy (more details), 2.4 Å
PDB Description: d100e trichodiene synthase
PDB Compounds: (A:) trichodiene synthaseSCOP Domain Sequences for d1kiya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kiya_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvledskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv
SCOP Domain Coordinates for d1kiya_:
Click to download the PDB-style file with coordinates for d1kiya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kiya_:
- d1kiya_ first appeared in SCOP 1.61
- d1kiya_ appears in SCOP 1.71
- d1kiya_ appears in SCOP 1.75
- d1kiya_ appears in the current release, SCOPe 2.08
View in 3D
