Lineage for d1khya_ (1khy A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779712Fold a.174: Double Clp-N motif [81922] (1 superfamily)
    multihelical; array
  4. 779713Superfamily a.174.1: Double Clp-N motif [81923] (1 family) (S)
    duplication: contains two structural repeats of 4-helical motif
  5. 779714Family a.174.1.1: Double Clp-N motif [81924] (2 proteins)
  6. 779715Protein N-terminal domain of ClpB (heat shock protein F84.1) [81927] (2 species)
  7. 779716Species Escherichia coli [TaxId:562] [81928] (1 PDB entry)
  8. 779717Domain d1khya_: 1khy A: [77410]

Details for d1khya_

PDB Entry: 1khy (more details), 1.95 Å

PDB Description: the crystal structure of clpb n terminal domain, implication to the peptide binding function of clpb
PDB Compounds: (A:) clpb protein

SCOP Domain Sequences for d1khya_:

Sequence, based on SEQRES records: (download)

>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvegtggdvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtla
dilkaagattanitqaieq

Sequence, based on observed residues (ATOM records): (download)

>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]}
drltnkfqlaladaqslalghdnqfieplhlmsallnqeggsvsplltsaginagqlrtd
inqalnrlpqvqpsqdlvrvlnlcdklaqkrgdnfisselfvlaalesrgtladilkaag
attanitqaieq

SCOP Domain Coordinates for d1khya_:

Click to download the PDB-style file with coordinates for d1khya_.
(The format of our PDB-style files is described here.)

Timeline for d1khya_: