Lineage for d1khba2 (1khb A:10-259)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1394734Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1394735Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 1394736Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 1394737Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 1394738Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 1394739Domain d1khba2: 1khb A:10-259 [68607]
    Other proteins in same PDB: d1khba1
    complexed with act, edo, gcp, mn

Details for d1khba2

PDB Entry: 1khb (more details), 1.85 Å

PDB Description: pepck complex with nonhydrolyzable gtp analog, native data
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic (GTP)

SCOPe Domain Sequences for d1khba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khba2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOPe Domain Coordinates for d1khba2:

Click to download the PDB-style file with coordinates for d1khba2.
(The format of our PDB-style files is described here.)

Timeline for d1khba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khba1