Lineage for d1kgsa1 (1kgs A:124-225)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) 
binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
Family a.4.6.1: PhoB-like [46895] (6 proteins)
contains 4-stranded meander beta-sheet in the N-terminal extensionProtein PhoB [46898] (2 species) Species Thermotoga maritima [TaxId:2336] [68972] (1 PDB entry) 
Domain d1kgsa1: 1kgs A:124-225 [68596]
Other proteins in same PDB: d1kgsa2
complexed with scn
Details for d1kgsa1
PDB Entry: 1kgs (more details), 1.5 Å
PDB Description: Crystal Structure at 1.50 A of an OmpR/PhoB Homolog from Thermotoga maritima
PDB Compounds: (A:) DNA binding response regulator dSCOPe Domain Sequences for d1kgsa1:
Sequence, based on SEQRES records: (download)
>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwsf
ddevfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde
Sequence, based on observed residues (ATOM records): (download)
>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwvf
sdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde
SCOPe Domain Coordinates for d1kgsa1:
Click to download the PDB-style file with coordinates for d1kgsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kgsa1:
- d1kgsa1 first appeared in SCOP 1.59
- d1kgsa1 appears in SCOPe 2.06
- d1kgsa1 appears in the current release, SCOPe 2.08
View in 3D
