Lineage for d1kgja_ (1kgj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1772956Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1772957Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1773497Species Norway rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries)
  8. 1773502Domain d1kgja_: 1kgj A: [77392]
    complexed with fl8

Details for d1kgja_

PDB Entry: 1kgj (more details), 2.3 Å

PDB Description: Rat transthyretin (also called prealbumin) complex with 3',5'-dibromoflavone (EMD21388)
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1kgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgja_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ageskcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekf
tegvyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsn
pqn

SCOPe Domain Coordinates for d1kgja_:

Click to download the PDB-style file with coordinates for d1kgja_.
(The format of our PDB-style files is described here.)

Timeline for d1kgja_: