Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [54890] (10 PDB entries) |
Domain d1keka5: 1kek A:669-785 [68528] Other proteins in same PDB: d1keka1, d1keka2, d1keka3, d1keka4, d1kekb1, d1kekb2, d1kekb3, d1kekb4 complexed with ca, co2, htl, mg, sf4 |
PDB Entry: 1kek (more details), 1.9 Å
SCOPe Domain Sequences for d1keka5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keka5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip
Timeline for d1keka5: