Lineage for d1kcw_6 (1kcw 892-1040)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (6 families) 
contains copper-binding site
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) 
Protein Ceruloplasmin [49559] (1 species)
consists of 6 domains of this foldSpecies Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry) 
Domain d1kcw_6: 1kcw 892-1040 [23156]
complexed with cu, nag, o
Details for d1kcw_6
PDB Entry: 1kcw (more details), 3 Å
PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms
SCOP Domain Sequences for d1kcw_6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcw_6 b.6.1.3 (892-1040) Ceruloplasmin {Human (Homo sapiens)}
rrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlq
gltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfp
rtpgiwllhchvtdhihagmettytvlqn
SCOP Domain Coordinates for d1kcw_6:
Click to download the PDB-style file with coordinates for d1kcw_6.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kcw_6:
- d1kcw_6 first appeared (with stable ids) in SCOP 1.55
- d1kcw_6 appears in SCOP 1.69
- d1kcw_6 is called d1kcwa6 in SCOP 1.73
- d1kcw_6 appears in the current release, SCOPe 2.08, called d1kcwa6
View in 3D
