Lineage for d1kbza_ (1kbz A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450365Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (2 species)
  7. 2450368Species Salmonella typhimurium [TaxId:90371] [75103] (4 PDB entries)
  8. 2450369Domain d1kbza_: 1kbz A: [72288]
    complexed with mg

Details for d1kbza_

PDB Entry: 1kbz (more details), 2.2 Å

PDB Description: Crystal Structure of apo-dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) from Salmonella enterica serovar Typhimurium
PDB Compounds: (A:) dTDP-glucose oxidoreductase

SCOPe Domain Sequences for d1kbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbza_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella typhimurium [TaxId: 90371]}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

SCOPe Domain Coordinates for d1kbza_:

Click to download the PDB-style file with coordinates for d1kbza_.
(The format of our PDB-style files is described here.)

Timeline for d1kbza_: